PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9KG230900.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 874aa    MW: 93701 Da    PI: 5.9716
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9KG230900.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.71.3e-20131186156
                          TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          +++ +++t++q++++e+lF+++++p+ ++r +L+++lgL+ rqVk+WFqNrR+++k
  Pavir.9KG230900.2.p 131 KKRYHRHTAHQIQQMEALFKECPHPDDKQRLKLSQELGLKPRQVKFWFQNRRTQMK 186
                          688999***********************************************998 PP

2START127.81.3e-403555912206
                          HHHHHHHHHHHHHHHC-TT-EEEE......EXCCTTEEEEEEESSS...................SCEEEEEEEECCSCHHHHHHHHHCC CS
                START   2 laeeaaqelvkkalaeepgWvkss......esengdevlqkfeeskv..................dsgealrasgvvdmvlallveelld 67 
                          la +aa+ l ++  a+ep+Wv+ +                  e ++                    ++e +r+s+vv+m++ +lv  +ld
  Pavir.9KG230900.2.p 355 LAATAADTLARMCRAGEPLWVRRRgassevM--------VPDEHARMfswpvdggkqgggstpaaARTEGSRDSAVVIMNSITLVDAFLD 436
                          5778999999************994444431........333333334555566678899999999************************ PP

                          CGGCT-TT-S....EEEEEEEECTT........EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE..TTS-EEEEEEEEE-TTS--..-TTS CS
                START  68 dkeqWdetla....kaetlevissg........galqlmvaelqalsplvp.RdfvfvRyirq.lgagdwvivdvSvdseqkppe.sssv 142
                           + +W e ++    ka t++vi+ g        g l+lm+ae q++splvp R+++f Ry+    ++g+w +vd   +  q     +ssv
  Pavir.9KG230900.2.p 437 AN-KWMELFPsivsKARTIQVINHGaasghlgsGSLVLMQAEVQFPSPLVPaREVMFFRYCVHnAEEGTWSVVDFPAEGFQLEALqTSSV 525
                          **.************************************************************99*********888888877779**** PP

                          EE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXX..HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                START 143 vRaellpSgiliepksnghskvtwvehvdlkgrlp..hwllrslvksglaegaktwvatlqrqcek 206
                          v+++++pSg++i++++ng+s v+wveh+++ g     h++++  v sg+a+ga +w + lqrqce+
  Pavir.9KG230900.2.p 526 VKCRRRPSGCIIQDMPNGYSSVVWVEHMEMVGEEKplHQVFKDYVASGTAFGATRWISLLQRQCER 591
                          *****************************98765449***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.5E-21120182IPR009057Homeodomain-like
SuperFamilySSF466891.96E-19122189IPR009057Homeodomain-like
PROSITE profilePS5007116.989128188IPR001356Homeobox domain
SMARTSM003891.1E-19129192IPR001356Homeobox domain
PfamPF000463.7E-18131186IPR001356Homeobox domain
CDDcd000866.87E-19131189No hitNo description
PROSITE patternPS000270163186IPR017970Homeobox, conserved site
PROSITE profilePS5084843.152345594IPR002913START domain
SuperFamilySSF559612.33E-28348593No hitNo description
SMARTSM002342.5E-17354591IPR002913START domain
PfamPF018521.2E-32355591IPR002913START domain
CDDcd088758.58E-101365590No hitNo description
SuperFamilySSF559612.06E-14608851No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 874 aa     Download sequence    Send to blast
MFGDCQVLSS MAAMAGASSS ADALFIPNPG ALAGFMSSSA AAAMPFHHFS TASLIPKEEG  60
GIMGALVPVA KDEDMELEMD MELSGGSGGG HLDGLLSFAD DDWPEQKPSG LELQTVDAAG  120
NQQLATNTGK KKRYHRHTAH QIQQMEALFK ECPHPDDKQR LKLSQELGLK PRQVKFWFQN  180
RRTQMKAQQD RADNVLLRAE NESLKADNYR LQAAIRNVVC PTCGHAAVLA EMSFEEQQLR  240
VENARLKDEL DRLACMATRY GGGRQPGMSS SALGCISAPA PHLLMPPLNL DMSVYSRHFT  300
DQSPVMGCGD LIQSVLAPPP SQQITAGAEH HDASPYMGSA MAPVPEQDRQ QVLDLAATAA  360
DTLARMCRAG EPLWVRRRGA SSEVMVPDEH ARMFSWPVDG GKQGGGSTPA AARTEGSRDS  420
AVVIMNSITL VDAFLDANKW MELFPSIVSK ARTIQVINHG AASGHLGSGS LVLMQAEVQF  480
PSPLVPAREV MFFRYCVHNA EEGTWSVVDF PAEGFQLEAL QTSSVVKCRR RPSGCIIQDM  540
PNGYSSVVWV EHMEMVGEEK PLHQVFKDYV ASGTAFGATR WISLLQRQCE RLASELARNI  600
ADPRVIHTPE ARTNMMKLSQ RMITTFCANI SASGSQSWTA LSESTEDTIR VTTRKNTDPG  660
QPSGVILTAV STSWLPFSHQ QVFELLADEQ QRCQLEILSN EGSLHEVAHI ANGSHPRNCI  720
SLLRINAASN SSQNVELLLQ ESSTHPNGGS LVVFGTVDVY AIQVTMSGGD PSYIPLLPLG  780
FAIFPAANPS PAATSESSGN GESSPGNPDV PATGCLLTVG MQVLASAVPS AKLNLSSVTA  840
INSHVCNAIH QITTALKGAG ASRAEPASVG GSN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1399405GGKQGGG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.76670.0callus| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983555.10.0PREDICTED: homeobox-leucine zipper protein ROC3
RefseqXP_004983556.10.0PREDICTED: homeobox-leucine zipper protein ROC3
SwissprotA2ZAI70.0ROC3_ORYSI; Homeobox-leucine zipper protein ROC3
TrEMBLK4A5P80.0K4A5P8_SETIT; Uncharacterized protein
STRINGSi034202m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46880.10.0homeobox-7